DPCstruct | MC3461
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 129 ± 18 aa |
| Standard deviation of domain lengths | 17.74 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B1N0I8 | 113-225 | NGNAGKIPLEAETIKLISLWSANDPKKMEKMIGIIFNAKKASETFITQQTGKPTTIFLDNYEDLQHDITVSLRRTFNAIRNKQDKKQ… |
| A0A370A5Q7 | 24-153 | HADEFLTDPESGWEAFLEPEAIQLLSFWCRTPQQMRRFIRIILNAKNNLEKEHQALGVKINLGDDTLKPLITKTLRRYFNVLRSNEK… |
| A0A3M0MV82 | 8-121 | None |
| A0A0M2ANM6 | 45-150 | None |
| A0A0R1NV52 | 102-220 | None |
| A0A091CBZ3 | 1-126 | None |
| A0A1Y0WC04 | 64-201 | None |
| A0A422M8Q1 | 48-171 | None |
| A0A0P0DY00 | 59-205 | None |
| A0A854Z976 | 58-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.