DPCstruct | MC34602
Metacluster Properties and Pfam Annotations
| Number of structural domains | 116 |
|---|---|
| Mean domain length (aa) | 190 ± 40 aa |
| Standard deviation of domain lengths | 40.17 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 73.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.51 |
| Pfam Score | 75.11 |
| Assigned Pfam label(s) | PF03271- CL0188 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0C3M2 | 2-208 | KSHNQGRQDFLQWINELTECDYPKVELLSDGIGYCQIIDALHPGAIYLSKLNFMARFPDEYTKNLKVLDDAFSKLKIDKVVPIDKLS… |
| B4JDL5 | 16-129 | KTFSRFAILAWCNKLLDSNIQKIDDLCTGAAYCSLMDILFPDSINLSHVKFDSRVDRDYIHNFTVLQKCFTKLKVKKGIPIEKLING… |
| A0A6A2XP27 | 2-218 | None |
| A0A6A5DZI2 | 76-290 | None |
| A0A4T0I9P4 | 470-696 | None |
| A0A7E4W251 | 8-186 | None |
| A0A6P4E4M1 | 5-202 | None |
| A0A7S4PQA0 | 4-189 | None |
| A0A3Q4H1H1 | 7-148 | None |
| A0A5B8MI60 | 1-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.