DPCstruct | MC34601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5709 |
|---|---|
| Mean domain length (aa) | 100 ± 18 aa |
| Standard deviation of domain lengths | 17.89 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 12.61 |
| Pfam Score | 83.22 |
| Assigned Pfam label(s) | PF18972- PF09280- CL0003- CL0219- CL0273 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0BY12 | 6-94 | ITDKGEQDMIQIMIEYPEKSKNYVINCESTVEIQTIIENLSSLLEMPQEAITLVYDRIRLNPNQLLNEYCQMNNQSAIVLTLEIKKD… |
| A0A6S8A0L4 | 190-294 | RREGFRTDVPVEPPAGAAGTTSVRVYCGDADVRRNFQSDHTLKGVIMWLGATLSSILPEKLDEGEWELVDRSYYPPKLLNVEQVKDS… |
| A0A6A5WV56 | 33-166 | None |
| A0A7R9PV78 | 726-816 | None |
| A0A7R9LV96 | 1-88 | None |
| A0A7R9LSD4 | 37-143 | None |
| K8EZ65 | 121-249 | None |
| K8EKF4 | 2-87 | None |
| K8EIG6 | 117-221 | None |
| K8EH60 | 8-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.