DPCstruct | MC346
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 60 ± 3 aa |
| Standard deviation of domain lengths | 2.79 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.96 |
| Mean intra-cluster sequence similarity (%) | 75.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B8KEE5 | 5-65 | EKVEKLIERNVIEVAPLAYMRGRTLNDAFIILDESQNTTVEQMKMFLTRIGFNSRAVITGD |
| A0A4Y1ZBR4 | 1-59 | MLGAEHTLRLIERGTIEIAPLAYMRGRTLEDAYVILDEAQNTTQEQMKMFLTRLGFGSK |
| R0MHY0 | 5-62 | None |
| A0A645IZT6 | 2-59 | None |
| A0A7W1SZF0 | 1-64 | None |
| A0A645I4J6 | 1-65 | None |
| A0A4U9TTC4 | 5-65 | None |
| A0A0N0I5E1 | 26-87 | None |
| A0A6L7ZJS3 | 1-56 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.