DPCstruct | MC34593
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 167 ± 29 aa |
| Standard deviation of domain lengths | 29.34 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 55.73 |
| Pfam Score | 98.29 |
| Assigned Pfam label(s) | PF00223- PF00124- CL0410 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B5YXA2 | 1-153 | MSALGRPQDMFSDTAIQLQPIFAQWVQNIHATAPGVTAPGATTSTSLACGGGELVAVGGKVALLPIPLGTADFLVHHIHAFTIHVTV… |
| M1WY86 | 9-133 | LQPVFAQWLQNLHTMAPGSSTAPNALTTVSHAFGGGAVAIGGKVAMMPIALGTADFMVHHIHAFTIHVTVLILLKGLLFARSSRLIP… |
| A0A7J9KA92 | 1-159 | None |
| A0A2G2XC02 | 117-270 | None |
| A0A5D2KKH8 | 298-451 | None |
| A0A7J9KJ29 | 192-362 | None |
| A0A1R3KZH4 | 2-206 | None |
| A0A3Q7EC50 | 131-283 | None |
| A0A3B6PKD4 | 324-523 | None |
| A0A445CGY6 | 131-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.