DPCstruct | MC3459
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 80 ± 11 aa |
| Standard deviation of domain lengths | 11.30 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287M7K8 | 3-62 | GKSRVTKFILQEILSVTVGDFVKKENLKVNPEIATTQSEGDLESSFAPGSSFGFNVILEL |
| A0A446T8Y1 | 6-78 | AQVPKEVALHLIGPSKVKKAAIKKIINRAVAEYVEKENLDASKNLKVLQSYEELEATFEPGKEFCFDAAVHLT |
| A0A7N2MSL5 | 1-72 | None |
| A0A199UT82 | 28-108 | None |
| A0A2N9IWJ6 | 97-192 | None |
| V7AF53 | 75-159 | None |
| A0A6P0YSX5 | 37-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.