DPCstruct | MC3458
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 93 ± 9 aa |
| Standard deviation of domain lengths | 8.55 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 45.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2MQS9 | 102-191 | GVALRPWVIYGERAISSSVRLPLHLLFGPVDQLLRRLPNARQLAGTPLAGPLFLPPVPVQAVARAAVAAATDPLVPPGVMDVWEIAK… |
| A0A446T056 | 1-98 | MVQTIILLFVGVILRPGFIHGTRRVGSVNIPLGLVGSPMQMVLQNAKPLTRLPLVGPMLTPPVSATSVAKVAVRAATDPVFPPGIVD… |
| A0A444EYV7 | 1-115 | None |
| A0A3L6PY35 | 917-1004 | None |
| A0A2P2J8Z7 | 61-145 | None |
| S8C8W2 | 409-496 | None |
| A0A425D7N1 | 7-99 | None |
| A0A7G2F6K7 | 599-686 | None |
| A0A7S2B4S1 | 81-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.