DPCstruct | MC34579
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 78 ± 10 aa |
| Standard deviation of domain lengths | 10.37 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 47.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G6E8T5 | 43-129 | KQTGRKIPGYSLNKKGEKIPDELIKEYLCELITGDGFPYGYKKLGICLKEDYKLIINHKKVYRLCKELDILRPQRKIYPKRPKKLAK |
| A0A2T6EPB7 | 2-79 | SEGRPAPGYSFKEDGQKVSDEQIKEFLLEEIAGDGYNYGYRKLTKVLRRKYNLKINKKKVYRLCKELGVLRPQRKKKV |
| A0A1V0UNL0 | 28-106 | None |
| A0A6B3WVL9 | 1-65 | None |
| A0A2T2WRJ7 | 69-156 | None |
| A0A2L1U5F4 | 145-223 | None |
| A0A847QPZ8 | 153-239 | None |
| A0A7V6MXE2 | 1-67 | None |
| A0A5C6RU82 | 70-157 | None |
| A0A6N7INS6 | 13-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.