DPCstruct | MC34578
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Standard deviation of domain lengths | 8.71 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 29.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150LFI4 | 1-96 | MIKLQGVIPAVRNMKDFDRILNSKQKYIILLETRLSLLRHAVKYAQKMDKQVLVHADLIQGLKSDEFGIEFLLRDIKVDGLISTRSN… |
| A0A3E0KHL2 | 69-165 | IAGAKDVEKVATALEAGIGIIFFLTGTIFDLARAAALVRQTPSMLFAHVDLLQGVGKDPAGIRWLGQELGIHGIVSTRSNLIKAAQD… |
| A0A535TT71 | 81-178 | None |
| A0A2R9SPT5 | 29-108 | None |
| A0A2H5ZVT9 | 27-120 | None |
| A0A061NDP0 | 16-103 | None |
| A0A356XFQ5 | 2-80 | None |
| A0A401ZT03 | 19-106 | None |
| A0A4Q1AXR1 | 1-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.