DPCstruct | MC34576
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 123 ± 20 aa |
| Standard deviation of domain lengths | 20.39 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F3FJU8 | 7-88 | NFKSTEMRFLDSIFDMGGGYVLDFSNRTMDEFFMEELEIDISHEMFSKDGTSKARRVRCLLQNADHPTVTRVLEALWKHRQT |
| A0A554KBL8 | 1-120 | MSSLKQVDKIKLEKLFGMNTGYVCDFWDSTFGEFVKENTGIDVYTEEYARGGTSKANRLRTFWKKESDELTAKLVGALLEYWRTLQL… |
| A0A1Y5SEC3 | 1-80 | None |
| A0A7I7TP87 | 1-138 | None |
| A0A2V9QW82 | 1-96 | None |
| A0A090DJQ0 | 9-163 | None |
| A0A7Y3WL57 | 9-153 | None |
| A0A1G7PAV8 | 18-141 | None |
| A0A3M9N355 | 26-160 | None |
| A0A4R7KNA3 | 124-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.