DPCstruct | MC34575
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 127 ± 11 aa |
| Standard deviation of domain lengths | 10.64 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 51.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V0SBA6 | 107-227 | SSNSSGTNVNGGRLFTVAVVGLSGSEREKGVAGVGKSCLCNRFVRPLEDDYCAEHISALSPVDFGGRVVNNDHWLYWGERSMLVESG… |
| A0A182SP69 | 2-140 | KQINVSVVGLSGVEKDKGQLGVGKSCLCNRFVRPKTDDYAIDHISVLSQSDFSGRVVNNDHFLYWGEARKTSEEGVDYNFSVIEQTE… |
| A0A6L5DDW3 | 4-137 | None |
| A0A4C1VV57 | 6-141 | None |
| T1HFB3 | 5-141 | None |
| A0A0D6LWC5 | 1-137 | None |
| A0A7R9AWF6 | 54-174 | None |
| A0A2K6R6A1 | 5-126 | None |
| A0A183Q941 | 3-133 | None |
| A0A6A4WNQ5 | 10-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.