DPCstruct | MC34574
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 57 ± 4 aa |
| Standard deviation of domain lengths | 3.88 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 41.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M4NMP3 | 1-53 | MKLQQYIDLFYDGSNTDFAVAQGVKPQQVTQWKNNGFIVVEHVLYSPRRELAE |
| G7LKY8 | 1-53 | MTLLAFIDKYFAGNQAEFARYLGVKPQQVTQWIDKGFIVVDDTLYSPRRKISK |
| A0A636GBL2 | 10-63 | None |
| A0A0B6XBB2 | 4-61 | None |
| A0A318NWE8 | 1-58 | None |
| A0A2D5PBN8 | 6-71 | None |
| A0A827CYD3 | 1-60 | None |
| B2PZ92 | 1-58 | None |
| G5NML5 | 52-105 | None |
| A0A1S1HL06 | 1-57 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.