DPCstruct | MC34569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 194 ± 26 aa |
| Standard deviation of domain lengths | 26.01 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 12.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9Y3B3 | 140-296 | VPGEHLYAVAVREGSDLWLALWVRRSLKPQFFIMLPRVDQGWNVHTSYHLDGTLHMKSHGRQVLPPTKRQPLTGTFRGTEHLGAFFG… |
| A0A417QGE0 | 2-175 | SKKEKYRFCIGDKNKHSSLTTIIPEKNDVYIVSKSNENQTKLSIHESGKCQYSFTSEYVKKNRIVERNRDRHLMEFELLPLSDRYEI… |
| A0A8A9ZTX6 | 1-211 | None |
| A0A4R7J4S6 | 70-303 | None |
| A0A2H0QT92 | 1-192 | None |
| A0A7Z6PLX1 | 5-198 | None |
| A0A1V1WAQ1 | 63-266 | None |
| A0A4R2ITJ0 | 3-193 | None |
| A0A497NXE2 | 4-132 | None |
| A0A2E8MU80 | 1-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.