DPCstruct | MC34566
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 119 ± 19 aa |
| Standard deviation of domain lengths | 18.91 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00624 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E3ZDE9 | 138-232 | GDTTFLNASVCERQSYRGYTVSGNYQWAESTESGCNRYFNLDLAVYPVDTVSINTVLTDTEEYMGYTQSGSYLCKYASSDACDSIVN… |
| A0A1G4JX22 | 138-273 | TTVTLRSSVLTPWGGSQTSTYSTSFTTLTGADGIKTVETVYYVETPIVNVLSTTIQPWSGSETSTYSTSFTTFTGSDGKETVETVYY… |
| A0A2G5KJS5 | 164-267 | None |
| A0A4Q3N2H5 | 53-156 | None |
| A0A3D4RNG3 | 264-372 | None |
| A0A4V0X5W2 | 15-139 | None |
| A0A132HWE9 | 7-119 | None |
| A0A172TQT8 | 2-139 | None |
| A0A172TQ60 | 1-110 | None |
| A0A2N1V1M0 | 588-680 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.