DPCstruct | MC34562
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 84 ± 9 aa |
| Standard deviation of domain lengths | 8.84 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15092 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A226ENG9 | 167-264 | NESDIFFMIPRGVLVQYGPYTFHGVCDFRVERLQGLQKVLQKMGAKVKMIPNTDYVNRVHVWYMDAVIFSCKITDFQFGGDGELDPL… |
| A0A482W4M8 | 2-83 | SIKIFFGPYESHGVIRHNTRRLFWLASNGYRVELIPTRFLDVVTFEIMGKQIYRCNIKSLMFNMAYEDDPVAQRIFKVINDH |
| S9WI14 | 31-107 | None |
| A0A212EZY4 | 5-89 | None |
| A0A493TT50 | 1-93 | None |
| A0A6J2CHF2 | 1-74 | None |
| A0A2K6Q7J6 | 1-74 | None |
| A0A6P5L3S5 | 60-152 | None |
| E0VYJ1 | 2-92 | None |
| A0A091EF06 | 1-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.