DPCstruct | MC34556
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 56 ± 6 aa |
| Standard deviation of domain lengths | 6.31 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 62.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4N8B2 | 1-56 | MFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDVSQNRLRESLELFKSI |
| A0A1S3QT79 | 112-164 | MFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNNTNRLREALDLF |
| A0A0B1TDW9 | 8-66 | None |
| A0A183USC2 | 13-65 | None |
| A0A0B1TPH9 | 1-53 | None |
| J9EBM6 | 5-51 | None |
| A0A7R8X3S0 | 95-142 | None |
| A0A7R9P0A4 | 68-123 | None |
| A0A498L5C4 | 283-331 | None |
| A0A6V7VKN3 | 97-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.