DPCstruct | MC34550
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 103 ± 7 aa |
| Standard deviation of domain lengths | 6.83 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 39.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K2CVF6 | 1-102 | MPKRSKAARKANSPNVVLAELKALLVGYGRQEIVAPLTQLGKTLKLGILGALSIGIGVIFLAIAGLRLLQTEASGVFDGNMSPLPYV… |
| A0A349B5X4 | 31-127 | KSVATVVSELWTLTIDYAKQEIKDPLTGLVSYVVWGIATMVLVGIGSILLAIGALRALQTQTGSTFTGSLSWAPYGIVLFGAVVVLG… |
| A0A524B197 | 9-105 | None |
| A0A2E7QAC2 | 1-91 | None |
| A0A7V9GJ68 | 13-117 | None |
| A0A7K2B3B0 | 27-137 | None |
| A0A359F1Y4 | 1-99 | None |
| A0A7W0R0U6 | 4-112 | None |
| A0A537YRG8 | 10-121 | None |
| A0A7Y3LBY5 | 1-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.