DPCstruct | MC3455
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 70 ± 8 aa |
| Standard deviation of domain lengths | 8.11 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 35.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B8QT54 | 6-63 | KTASTTAVSFWTLEQYDWKPLRKWCQDRNLEIEKEMVNGLQINSYPAQAWLEVYGIVL |
| A0A198UQ03 | 9-68 | SASTTEVYLRTEVLYPWVKLKRWCKQNNTQPIKKDHYGLMINHYPASAWLEVFGVDIQEV |
| A0A6C8WKC7 | 11-85 | None |
| A0A744CQ92 | 149-231 | None |
| A0A431ISX6 | 274-354 | None |
| R6GJG3 | 1-71 | None |
| M7CWZ8 | 69-133 | None |
| A0A0U2B1J7 | 41-108 | None |
| A0A3S4DWF9 | 95-157 | None |
| T1IB79 | 341-405 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.