DPCstruct | MC34549
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 448 ± 47 aa |
| Standard deviation of domain lengths | 47.07 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K2CR48 | 3-419 | ILVVLLLAAGAAYLPFADRGGSDTPEGAVSRFLGEDTDRGMLDRLASVAPAEITSAVGTLHKATAGGADEPDGGLLGIVDGFSLNAS… |
| A0A7Y2IHN9 | 1-438 | MAGKSGKAGRFAVAGLLGALAIGGGVAATAALRAPEGPASSEEAVELFFAALDNEDLVGVAEVMHPGERESLAQPMFDMAGHMRRLE… |
| A0A417XWS5 | 23-434 | None |
| A0A5Q2RM95 | 33-480 | None |
| A0A520XZ73 | 18-590 | None |
| A0A2S0LPZ6 | 1-414 | None |
| A0A6J6YG71 | 1-423 | None |
| A0A554UV39 | 21-459 | None |
| A0A1M3FDZ0 | 99-559 | None |
| A0A5F0DY69 | 95-547 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.