DPCstruct | MC34545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 122 ± 18 aa |
| Standard deviation of domain lengths | 17.53 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 44.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03909 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7BW15 | 1-149 | MELRIKLLMENGELHRLHKQLVIGHVLTETEFWANQKKLLDRDSHRKSKQRVGFNSVMISDIKPSTDGRTNRVKFNLNQEIIFQIFA… |
| V9IKM0 | 2-115 | LQENPILLQLYRDLVITQVISSEEFWSQHAAEYTQAKKSQRQEIGVNSAFLADIKPQTDGCNGLKYNLTVDIIECIFKTYPAVKRKH… |
| A0A833VU09 | 66-165 | None |
| A0A287WU77 | 1-105 | None |
| A0A7J6AFD4 | 112-214 | None |
| A0A2T9ZA28 | 160-305 | None |
| A0A151MCJ6 | 126-245 | None |
| A0A2P6VEB6 | 132-255 | None |
| A0A287MAD0 | 236-373 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.