DPCstruct | MC34540
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 210 ± 23 aa |
| Standard deviation of domain lengths | 23.05 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5PIE9 | 1-197 | MHNLFGGLLDTAQELKRVTPYHAAHATTVVDRANIPGGDDRWYNNVFTGGATEPPKVDPKIFNARRRFTGYGTWIYDAREHPSFAGG… |
| A0A7X7X1Z0 | 66-292 | ALVHNLICGAFTSVGDGTHWRYTPYHIPHRTEVMGFMTILHGDNRFYNNVFVQKWPSEDYVTYNDQDPQEAISENRLVGTHVFDEYP… |
| J9W5J7 | 4-216 | None |
| A0A3Q9BL50 | 134-389 | None |
| R5JR92 | 135-346 | None |
| A0A1V2M7P2 | 1-208 | None |
| A0A5B8VST2 | 54-263 | None |
| A0A7X7K7C2 | 230-453 | None |
| A0A5M5X6L2 | 1070-1252 | None |
| A0A7V2X8J1 | 24-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.