DPCstruct | MC34539
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 207 ± 44 aa |
| Standard deviation of domain lengths | 44.32 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5M8U8 | 28-223 | LATVAFDGLNKTFWYLDLIAVNPLEFPGRSAVMAENTVGLVAMFLAMLACYLGAVWAGGRIGGASRPLADAAPLVLSLLPISLAFHF… |
| A0A5Q4G9W9 | 292-508 | VRAPWREALAGAWRRRGGVSLAVLAIVLLWAGVMNAVAMIPPFFAAADAVATTLGTRNETLVLGLLFTLVIGVGGALTLGAFALGSL… |
| A0A838KSF1 | 21-201 | None |
| A0A7C1L2S3 | 795-1008 | None |
| A0A5N9B2V3 | 81-269 | None |
| A0A2H0P676 | 387-619 | None |
| A0A535A394 | 11-168 | None |
| A0A0M8YEC8 | 176-347 | None |
| A0A7C7QQM2 | 33-243 | None |
| A0A7X7P8W8 | 2-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.