DPCstruct | MC34538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 122 ± 23 aa |
| Standard deviation of domain lengths | 23.23 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 17.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0116 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K9IF83 | 3-147 | KQFKTLEDFLGTHFIYTYDNGWEYEWYAKNDHTVDYRIHGGMVAGRWVKDQEADIVMLTEGVYKITWTEPTGTDVALDFMPNEGKLH… |
| A0A139AU44 | 22-145 | IPELDESDLSGIINKHVVYTYDNGWLYESWFKSPTRIVYRIHGGPMGGRDNLQTYTTRRVRSDVYMISWMEETGTTVTMVVDFARLR… |
| A0A3D8SME9 | 47-169 | None |
| A0A812M9E1 | 9-166 | None |
| A0A7G8BGL7 | 4-132 | None |
| A0A2E4AYQ6 | 32-135 | None |
| A0A7W3JTX0 | 32-144 | None |
| A0A7I9Z0K8 | 84-240 | None |
| A0A0B8N1C0 | 9-129 | None |
| A0A2E8EVJ9 | 25-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.