DPCstruct | MC34536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 110 ± 15 aa |
| Standard deviation of domain lengths | 15.24 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 44.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06991 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0R300 | 1-118 | MTNEQILEEDKQLGLHQKKQQRQYNFMQKYYHKGAFYQDDEDEVFQRDFNMPVGEELMDKSVLPAILQKRRGTYGKKGQSKYTHLTD… |
| Q9P7H6 | 227-331 | LMNSEEREAQDLKDAEASRRGKKKSSMQFLQKYYHKGAFYQNEDIVSKRDYSEATEGEVLNKDLLPKPMQIRGDLFAKAGQTRWTHL… |
| A0A3P7AKR4 | 203-315 | None |
| N1QQS3 | 482-586 | None |
| A0A7D8V2M0 | 246-345 | None |
| A0A5C3EKS8 | 269-422 | None |
| L9JPZ3 | 35-162 | None |
| F4Q8R6 | 334-446 | None |
| A0A0E0HQA9 | 3-83 | None |
| A0A2C9VI48 | 14-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.