DPCstruct | MC34535
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 393 ± 96 aa |
| Standard deviation of domain lengths | 96.41 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 69.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.72 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 27.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04006 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0R0Q0 | 98-433 | EYSEQLDFNEMEAFLDKQEQEDIQEDSEAEEELGSEYEFDDKDSQMGEGDEGFKFKGKDDYEEDEEENMNKEEEKLREKDYDLEDEI… |
| A0A418BV01 | 3-200 | RPENSLLEADLEYDRPTKVAPIITVEVTQELEELIKTRIRDENYDDVVRKLAVNDGAQKEAAELSMEKSKEGLGDVYEKEFMKSAMG… |
| E9IT14 | 7-440 | None |
| A0A1E3IAQ5 | 248-741 | None |
| I7IG01 | 211-542 | None |
| B8BLX8 | 90-534 | None |
| A0A5J4WT55 | 6-298 | None |
| A0A446U335 | 11-423 | None |
| A0A446U355 | 26-330 | None |
| A0A1X2HXW7 | 407-917 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.