DPCstruct | MC34531
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 260 ± 33 aa |
| Standard deviation of domain lengths | 33.20 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14309 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0QYL9 | 5-249 | VESRIDEQLNNQSTKDKSEQYGISTNLYTVEQYIINLYKYAQDKYLQEFLLNINTSFGFSPKKRLKLIHGYDTFTQQNKELQNLPFV… |
| A0A1R2C8B2 | 919-1154 | NLPQNINPIISSDPRIETNPNFVRNFIKDVLGNVDILSIEDELIKGITRNPLENLTQIHELDLGNVVDRGTYPAILNIPAIVENIFD… |
| A0A0V0QR57 | 91-363 | None |
| G0R0G4 | 1-280 | None |
| G0QXF6 | 2-196 | None |
| G0QLQ2 | 149-413 | None |
| A0A1R2BH39 | 920-1218 | None |
| A0CTI7 | 495-817 | None |
| A0CSC4 | 833-1093 | None |
| A0E2T4 | 259-553 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.