DPCstruct | MC3453
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 227 ± 22 aa |
| Standard deviation of domain lengths | 22.12 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S6BXE2 | 51-295 | LPPERDLVREPYRYDRAISMGRVPGIKLYTYTPGRQEKVVGFALVNKGSPWVNPRGLEGTGARREFLFQYPDRAREEIFLSVLDDVR… |
| A0A2E6H9E0 | 26-231 | VGEFGNLGSMRYQVGYFEKYDKCFLSIGPNNRYPKYRGYHFDSAGELMVFNSLGAGRPSKDTGARNFQFPVITSELKYKLDFEDEYI… |
| A0A838EZG5 | 21-250 | None |
| A0A534SG43 | 60-319 | None |
| A0A2E2UB48 | 178-409 | None |
| A0A1F3V6X1 | 133-342 | None |
| A0A2H0QHH7 | 1-270 | None |
| A0A849SUR4 | 2-197 | None |
| A0A1F3XSN3 | 12-233 | None |
| A0A2E4DFP4 | 209-418 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.