DPCstruct | MC34528
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 176 ± 32 aa |
| Standard deviation of domain lengths | 32.16 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0131 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0QRU5 | 3-194 | LFVIRSWIFKYIFTPVYKNNQYHVDELSSIIKDLLKWLTFRLNYASGILKLTHQCSTSQNLTALKFYIQSQPLPNTFSWYFYNLPEY… |
| A0A1C5BMP9 | 128-267 | LLLETGFLAIFLGTGDTAAPVLVLWLLRWLLFRLEFGAGLIKMRGDACWRRLTCLDFHHETQPMPGPLSWFFHHLPRPVHRVEVAAN… |
| A0A7S4E654 | 184-333 | None |
| A0A3P8GZ86 | 1-145 | None |
| A0A100I0K6 | 149-307 | None |
| A0A2B4S7Y5 | 4-203 | None |
| A0A6P8J628 | 167-361 | None |
| A0A4S2M9V9 | 156-313 | None |
| A0A5A8DEG6 | 194-414 | None |
| A0A6B1KX58 | 128-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.