DPCstruct | MC34524
Metacluster Properties and Pfam Annotations
| Number of structural domains | 184 |
|---|---|
| Mean domain length (aa) | 161 ± 28 aa |
| Standard deviation of domain lengths | 28.44 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 73.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 33.98 |
| Pfam Score | 48.67 |
| Assigned Pfam label(s) | CL0031- CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0QJM6 | 304-469 | FKFYAEDTQNNIVIVTQKGIVRTNCLDCLDRTNVFQSKIALDILNVQLHQLGVNLFEQFGEDPLDHVDSSTEENHPFIQKFKCLWAD… |
| A0A7S2F3U2 | 13-121 | PYKELEKVFKDMWANNADALSLLYSGTPALKTDFTRTGKRTLMGLLADGVHSTARYYLNNMVDGSRQDSIDLMLGRFVPSVHKPTPF… |
| A0A7S1PGT2 | 529-735 | None |
| A0A7J0E7A8 | 31-198 | None |
| A0A7S1YPH1 | 287-485 | None |
| A0A3P7CHM1 | 298-427 | None |
| S4RPY9 | 26-178 | None |
| A0A834AMK2 | 3-114 | None |
| A0A1B0AHI7 | 117-283 | None |
| A0A812Z1B2 | 73-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.