DPCstruct | MC34507
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 89 ± 14 aa |
| Standard deviation of domain lengths | 14.01 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 46.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05535 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A8P6V0 | 37-122 | RNYYGATFINTDGIQKLCTSHADCYDMREPIYWCRLKRNQHWTEKGCYCDSVLRACIIERMTDLGPASKIRNYAYCTPRAFWNCPP |
| A0A1I7VS44 | 7-82 | YQKLKVKLRKKECKSHEACYDQREPQDWCRLNENQSWTDKGCYCDDKLHSCIIERKNGGKLEYAHCAPEQGWKCPS |
| A0A5S6QB71 | 102-195 | None |
| A0A0N5CMX8 | 305-391 | None |
| A0A0N5D7L8 | 15-99 | None |
| A0A3P7E3Z2 | 94-190 | None |
| A0A4X3PF62 | 314-390 | None |
| A0A5S6PY43 | 147-246 | None |
| A0A5S6PYS6 | 12-80 | None |
| A0A0J9XNS3 | 56-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.