DPCstruct | MC34504
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 102 ± 21 aa |
| Standard deviation of domain lengths | 21.38 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 64.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 46.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2REB2 | 2-100 | QTLYSCENGIEVRTMMENKRSPCSVDHGSFTPLASKRQKSDLSISTKDRKDKVGERIVTLQQLVSPYGKTDTASVLLQAMEYIQFLH… |
| A0A1D6J9A9 | 1-69 | MSSKKPRNASPRLAPVSPKEKKDKIGERVAALQQLVSPFGKTDTASVLQEASGYIKFLHQQLEVLSSPY |
| A0A4Y1S057 | 64-176 | None |
| A0A835PYP4 | 1-93 | None |
| A0A3Q7ES06 | 19-130 | None |
| A0A822Y1Q0 | 1-93 | None |
| R7W639 | 98-205 | None |
| A0A446N463 | 15-143 | None |
| A0A022QJW2 | 154-238 | None |
| A0A6P8C743 | 101-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.