DPCstruct | MC34503
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 98 ± 11 aa |
| Standard deviation of domain lengths | 11.21 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 45.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03592 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P6TQB2 | 49-153 | RNPKITKAIAERRKTLSESTDITPEKVLALWWARANVNVNEIVEYRRDNCRYCWGEGHAYQWTQGEYEQAQREADANGTDSPDAAGG… |
| A0A7U4Q7B9 | 13-104 | NRGFEQLHKNAVLSGQEVLRHWHDIAIADTSEISQMRRCCCCRHCWREPFFYQWRDIDEYDRAAEKAVKDGKPQPEYSRLGFIDNDD… |
| A0A377XAF5 | 13-86 | None |
| A0A379W8C4 | 1-89 | None |
| A0A5N9VY89 | 44-148 | None |
| A0A4V3HAF6 | 149-254 | None |
| A0A839L8Y3 | 4-88 | None |
| A0A485BN65 | 136-240 | None |
| A0A6M5HTE7 | 137-242 | None |
| A0A839ZG92 | 20-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.