DPCstruct | MC34500
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 71 ± 9 aa |
| Standard deviation of domain lengths | 8.66 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 37.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04384 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V8W4I5 | 1-64 | MKWSDTEDIAIQLVEAHPDMDPLAVRFTDLHKWVTELPEFKDDPDKSNEKILEAIQMSWHEEYQ |
| D1ASN4 | 11-87 | VTITSHNVRFVGVQSVKWVDVEDIACSLEDAYPNQDIFALRFTELKSMVVGLPEFDDNTDGCNEKILEAIQMAWSAE |
| A0A2E2B0Z2 | 5-72 | None |
| A0A7C3H0Z9 | 2-55 | None |
| A0A2X1SLU2 | 106-176 | None |
| A0A011QW34 | 579-663 | None |
| A0A6I7PV47 | 1-71 | None |
| A0A0S8BQV2 | 1-70 | None |
| A0A1I1L422 | 29-95 | None |
| A0A7C7V618 | 1-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.