DPCstruct | MC345
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 70 ± 6 aa |
| Standard deviation of domain lengths | 6.42 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 56.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H4N0D7 | 1-62 | MGWADNAMELPDNGLIKSCVHLVSAHEQRLCFPLDSICRHDGTYPSYAKEMVYPGMHSDIGG |
| A0A2X5BYZ8 | 1-71 | MAWADDNLALPDESQFPGFIQRCCHFVSAHEQRLCFPLDSVRRTEGNYPASTFEVVYPGVHSDVGGGYARG |
| A0A485C653 | 167-243 | None |
| A0A1I1WFA3 | 145-206 | None |
| A0A447L614 | 136-207 | None |
| A0A0N0GPS9 | 288-354 | None |
| A0A2V0R1G9 | 1-68 | None |
| A0A377TR63 | 1-69 | None |
| W1DMH2 | 9-79 | None |
| A0A3N1J5X7 | 300-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.