DPCstruct | MC34496
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 66 ± 6 aa |
| Standard deviation of domain lengths | 6.00 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 51.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03676 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K2V117 | 179-239 | FSRWDTIASKVNPSERPVVLNRASSTNTTNPFGSTFCYGYQDVIFEVMPNGHLASVTLYCS |
| A0A368H451 | 1-64 | MRFSDICGVFTDASGEYEEPQPVVVSRNTQEDRNPFGSTFCYGTDQIVVEVMDNGHIAAVTLFE |
| A0A7J6ZE63 | 849-922 | None |
| A0A7R8H6N4 | 60-121 | None |
| A0A2W1BFG6 | 87-159 | None |
| A0A455ABE6 | 355-426 | None |
| E2REW8 | 451-521 | None |
| A0A0V0U4N7 | 887-958 | None |
| A0A453SH78 | 209-267 | None |
| A0A2B4SY53 | 281-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.