DPCstruct | MC34495
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 476 ± 75 aa |
| Standard deviation of domain lengths | 75.23 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 70.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.29 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 15.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0687 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F8AH69 | 2-501 | AQLTSATPPSPETHPTVLSSLSFEHSYTLPPSVSAVKKDHSYPQPASQSPPPPTAEYPIAPTEVVIGDVPRTHSMCPHCSVVLYKRN… |
| A0A0D0BQU0 | 1-399 | MSQNAGVGGPSADEEGGFWAYSDAVQCEAVGFVQLHSCLYAVEGWLRETGQGNRHWYHFELSGGISNCKLVCLCPAGIWSCFHKCYY… |
| A0A1X6PEM7 | 163-530 | None |
| A0A7D9DIJ6 | 230-777 | None |
| A0A4Q2D407 | 36-476 | None |
| A0A7M5WZT4 | 3-371 | None |
| A0A6S7FSJ2 | 1-390 | None |
| A0A6S7G0R9 | 5-422 | None |
| A0A1X6PI74 | 11-586 | None |
| J0D9D7 | 8-380 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.