DPCstruct | MC34494
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 521 ± 100 aa |
| Standard deviation of domain lengths | 100.40 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.41 |
| Pfam Score | 96.30 |
| Assigned Pfam label(s) | CL0020- CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D0IQ88 | 7-420 | SVITDWKRLWPMVSGIHYETPQDTVREELMNVASELQAGVLQFKPKNASSLELGTLLKEKKQEKLLPFTERLQDLLDLESAQCWEIL… |
| A0A0F8AE74 | 393-948 | RNPPKSAEQREKVRKASTEGIAIQGQQGSRLLPEQLLKEAFILSDLFDMGELVALELLLAGEQQQPHFPGLTRGLVAVLLYWDGRLC… |
| A0A177WS89 | 53-709 | None |
| B8PIK2 | 10-750 | None |
| D3BJS9 | 1-552 | None |
| A0A6V7U2P4 | 22-420 | None |
| E7EXJ6 | 48-626 | None |
| A0A2G8L4V0 | 97-609 | None |
| A0A835R6B9 | 2-445 | None |
| A0A0N1PIH7 | 70-571 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.