DPCstruct | MC34491
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 381 ± 36 aa |
| Standard deviation of domain lengths | 35.55 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07778 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8A3PKE1 | 6-354 | GDEQNVDDILDDVENASRIPAKQRSVKVSSHVDRLCLRAYGEGLSNASLERLIDIITLPNELDQGSIGSLVKHLYPRSKVPDAVVIK… |
| A0A0L8RF94 | 3-433 | LVLDDIVRSLTNSNERTPLQTLKTTLHLLYEKSKQYGLSSPQLQVLVRFICETSVIDTVTKVYIVENCFLPNEYLTKDPILEVINHL… |
| A0A163IXU1 | 11-400 | None |
| H3C3F9 | 1-346 | None |
| A0A367J5X5 | 16-386 | None |
| A0A058Z4U2 | 116-511 | None |
| A0A1X0RZ40 | 15-408 | None |
| A0A077WX33 | 8-378 | None |
| A0A4U0XRC7 | 1-393 | None |
| A0A5J4WTD0 | 6-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.