DPCstruct | MC34471
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 130 ± 24 aa |
| Standard deviation of domain lengths | 24.49 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18847 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0U5BIW8 | 3-122 | DVVEIAKQIRTVLKKEFPATKFSVRSERYSLGASIRVSWDGLPSTATVSTITDSFAKVRYCDATGEILSGGNMFITAQASETDEVRA… |
| A0A1U9YVD8 | 7-119 | ERATETAKKIRKTLKKAFPNTKFSVRSSTFSMGSSVYVSWVDGPLKSDVDSILNRFKSGYFDYMTDVYKITGYEWEGKLVVGAKYIS… |
| A0A386ZBN5 | 2-155 | None |
| A0A7T8M2V6 | 112-255 | None |
| A0A7J9TGS0 | 2-105 | None |
| A0A6L8A0M3 | 22-212 | None |
| A0A3E0VRG1 | 5-111 | None |
| A0A7D5UL37 | 194-327 | None |
| A0A6M3JQY0 | 95-201 | None |
| A0A2E4PJI8 | 181-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.