DPCstruct | MC34470
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 224 ± 29 aa |
| Standard deviation of domain lengths | 28.56 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 72.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 14.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0424 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U9YTT5 | 12-225 | TMPAGAEAGEGIKRLLQALGIDHEHHLGKMLMGVHGETAPLPGGAEHQAARATETLKGLLLQATATDDLPPVVKEAAQQTIQHITGQ… |
| A0A2A5DRG9 | 244-441 | ASLKAALEILGKTDPAIQATLINATLPTAGKDMVAKLFHFFSALSKGDIRDWLGERTLRSIESAGKGALAQKLSDEFIQLSRLALRG… |
| A0A2G4YSH6 | 830-1065 | None |
| A0A3D9WZ44 | 57-315 | None |
| A0A5C7TGG9 | 416-691 | None |
| A0A4V0HXW1 | 501-665 | None |
| G4E2M2 | 867-1137 | None |
| Q1NIM6 | 14-196 | None |
| F2J490 | 203-408 | None |
| A0A2A4VNW5 | 554-806 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.