DPCstruct | MC34466
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 299 ± 32 aa |
| Standard deviation of domain lengths | 32.12 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0374- CL0365 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N0ZI92 | 18-377 | IKPIKLSLKNVLEFHNEHLELVPLFDMKEINLEQKEIAHSTLIRPQFALAGYLDYFTDKSIVILGRTEASFLNRFDLDEQMTIISKL… |
| A0A1Y0VS18 | 1-231 | MTKDERTKIYDRMADVDTPAFVVSRGLPIPEELIQAAKNNQVPILTSTLPTSRLLSNMTNFLEDRLAERDSIHGELLEIYGLGVLIT… |
| A0A426FN80 | 3-315 | None |
| A0A6L5DCX7 | 393-694 | None |
| A0A2V7KJM4 | 1-248 | None |
| A0A1S9D3E9 | 2-334 | None |
| H1DCG6 | 3-237 | None |
| A0A7V2Z224 | 47-363 | None |
| A0A2D5EST8 | 391-708 | None |
| A0A4R7LC94 | 320-636 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.