DPCstruct | MC3446
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 133 ± 28 aa |
| Standard deviation of domain lengths | 28.00 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.46 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | CL0052- CL0426 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P5YI53 | 17-140 | TKVVNVDVCRVKANTDVLTNFEVLDLINSKRASKDTTRVIAAVARSEYKVCNYLNETVASTQTLESVTTFSNKCKDFKLTKVEILNI… |
| A0A849PQV3 | 1-116 | MLKTISETPVTFAEAKSVLEDKEKELKNNERELGHEQRITLEYLRVIPILDKKTSEETAKNLLEAVPTLKEHQVIMIIDTLPDCEED… |
| Q9C0Z9 | 1-127 | None |
| D8R887 | 1-149 | None |
| A0A7S0Y7Q5 | 1-223 | None |
| A0A6V7NV80 | 178-255 | None |
| A0A5A7QQ54 | 631-756 | None |
| A0A194RSN3 | 355-485 | None |
| Q74ME2 | 7-103 | None |
| A0A835CUV7 | 57-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.