DPCstruct | MC34457
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 144 ± 18 aa |
| Standard deviation of domain lengths | 18.18 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A544Z3P7 | 1-165 | MEPEHQADPITHVRVDHRLQSRTCAWCGTAVPYSGRGRPASYCSKSCRNRAWEVRTAEARLQRDIATGALRAEPVREVIRETVTRTQ… |
| K6VN85 | 52-189 | EQPAPPTTRSRRPPRVAGQQAACGWCGASVAVPARGRVPKWCSDTCRHRAWEQRRAAASGRSAVHVIDRTIETVKTVTVVQRERVEV… |
| A0A3E0G5Z9 | 2-179 | None |
| A0A7W9PN27 | 1-123 | None |
| C1BEF6 | 1-127 | None |
| A0A2T0TPQ5 | 1-124 | None |
| A0A543PE51 | 1-157 | None |
| A0A7V9R807 | 4-144 | None |
| A0A4T0VAS0 | 1-125 | None |
| A0A1R3UFL9 | 7-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.