DPCstruct | MC34455
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 128 ± 6 aa |
| Standard deviation of domain lengths | 5.52 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 93.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 66.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020- CL0364 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A098TMA6 | 77-208 | TSPLITPLEAIELLGTMMGGYNVRSLIDLLQAADAEIAAAATTALSKTLLVYDAFHDVQELAAQGHPSAAQVMHSWAEAEWFTSRPP… |
| A0A7S3S5U1 | 123-253 | ETNALISKKKAVELLGTMQGGYNIAPLIDALEDAEVAETACTALKHTILVFDAFHDVKAKMDAGNEYAKKVIESWAAAEWFTSKPEV… |
| R1DPH4 | 103-233 | None |
| A0A6M1HUN5 | 1-131 | None |
| A0A812RLG3 | 50-164 | None |
| A0A812QR35 | 110-240 | None |
| A0A0B7IYJ2 | 536-666 | None |
| A0A484ZJB7 | 76-197 | None |
| A0A6D0F9X7 | 5-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.