DPCstruct | MC34452
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 218 ± 27 aa |
| Standard deviation of domain lengths | 27.20 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 68.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183WC48 | 1-205 | MQFFSLLNKADKAKVKKLAKDRPSKKQLRAAAEMEDGTWTTIDSYGRAEVQIQAFEKGQEINFEVVVRRMEEILASRGKKGTSTSDQ… |
| A0A835J9F1 | 11-188 | DDQSEKDGGWEKMMSKKDKLMDKQFAKDPSEITWDIVNKKFKEIVTARGRRGTGRFEQVEQLTFLTKVAKTPTQKLEILFSVVSAQF… |
| A0A376B2L8 | 235-435 | None |
| E2LUV5 | 145-383 | None |
| A0A6G4ZZJ5 | 205-449 | None |
| A0A1S3IUF1 | 158-407 | None |
| A0A7J7IG37 | 85-261 | None |
| A0A7J7L534 | 195-424 | None |
| A0A2R7VZW8 | 76-286 | None |
| A0A396JF28 | 2-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.