DPCstruct | MC34446
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Standard deviation of domain lengths | 5.19 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 55.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183W7F9 | 6-77 | TKYSELTAKIFHAVRLDNCHSTPLHVAQYMIDKARAVRPNLYVVAELFTGGEYVDNIFINKLGLSSLIRGKF |
| A0A402ECN8 | 31-103 | WAHMKKYTEMTAKYFHGVRLDNCHSTPLNVAEYMLDTARKLRPNLYVVAELFTGSEELDNVFVNKLGISSLIR |
| A0A3P7NN12 | 169-244 | None |
| A0A3P8J700 | 181-253 | None |
| A0A4Z2E7Y0 | 124-199 | None |
| K7I733 | 34-124 | None |
| A0A820Z1A4 | 105-168 | None |
| A0A0R3RN24 | 240-315 | None |
| A0A183QFQ2 | 1-74 | None |
| A0A2H1C542 | 308-380 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.