DPCstruct | MC34444
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 93 ± 17 aa |
| Standard deviation of domain lengths | 17.14 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 44.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183SDH1 | 16-103 | FDLEDPSKLLHPDNVDLAALQQLSRDVATFATHGGLSRLDFAVNAYDQPDVAIFDFTSLSAAEYACRIVDRLGRPLFQCLVGDALVEP |
| A0A183W5Z7 | 36-127 | KDRDDSVSLLCKDNVDKLALQAYARETASYVTNGSLTRLDFALNSRGEPDVDAFDFTKMFAAEYSCNILEKNHCLLLQCLIGDGLYE… |
| A0A044QUV2 | 304-393 | None |
| A0A6I9YXA1 | 33-120 | None |
| A0A833T255 | 42-121 | None |
| A0A183NPB6 | 3-92 | None |
| A0A368FWB0 | 108-194 | None |
| H3B992 | 305-405 | None |
| A0A4Z2HK01 | 16-103 | None |
| A0A821LKI1 | 13-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.