DPCstruct | MC34442
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 85 ± 9 aa |
| Standard deviation of domain lengths | 8.74 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 48.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9R9M1 | 61-142 | DTWMDKIWGHNVTEFQKRFDATETQNEGPRRLKNLYFLYLIELRAISKVLPFFERQSFLLYTGNDTKDLETKQLLIELLHDA |
| A0A183W4Q0 | 2-79 | NLSQSWGPNLEEFRRRFDPSIVPDGPIRLRNLYFTYLVELRALAKAAPYLLKQNYFTGDSEMDRETRTAVKDFLHIIQ |
| A0A444SQW4 | 56-136 | None |
| A0A3P7PZ30 | 3-99 | None |
| A0A4U1EX65 | 29-114 | None |
| A0A4Z2E8A1 | 1-98 | None |
| A0A7M3RK56 | 97-186 | None |
| A0A3Q0J7A7 | 31-117 | None |
| T1EI67 | 1-77 | None |
| A0A811V0C7 | 277-360 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.