DPCstruct | MC34441
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 92 ± 6 aa |
| Standard deviation of domain lengths | 6.49 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 76.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 41.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10221 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A2JQI2 | 334-426 | ACGELLIRTTHTLTIRLYDLVSTTVSGIPMKEEAQPAQSVNYDVELLHPRDVHAMLESLGLLSDKFLLSKVSDLPDSSYSTVRLSWA… |
| A0A183HS11 | 1-93 | CAEAGPSLRPVLHGVILKHFNLASTTVTGIPMKEEAQQGQSVNYDVEVFHPRRSHYLLHQYGLIGPGSKLRVTVDPGDYETVKLAWT… |
| A0A183N9Z0 | 1-93 | None |
| A0A0S7KYL0 | 43-130 | None |
| A0A812B6S8 | 51-140 | None |
| A0A5K4F9T5 | 1-91 | None |
| A0A3Q0IPR2 | 159-247 | None |
| A0A2H1C5D3 | 216-309 | None |
| A0A226MMP3 | 154-247 | None |
| A0A3P7LNF5 | 236-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.