DPCstruct | MC3444
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 325 ± 56 aa |
| Standard deviation of domain lengths | 56.22 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 35.90 |
| Pfam Score | 92.31 |
| Assigned Pfam label(s) | PF05431- PF06880- CL0066 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A398AWT4 | 45-371 | TILKTLSQFRKYQKTLSEESPEGPFSAVLVIIDEEAETDDTFCFGMCKSTKIEMLPFPQDKILSVVHTDSSGNRDTSVKKVLFIRKF… |
| A0A6I9Q8C4 | 21-387 | PPEGPNSGYLVLQDEGPDVAEPTCCWGLCKDTRVRDLPFPQNRILTIEYTQPNGQSSATYTEVVIFVPVMDQPLSSNRYYVILVKGK… |
| A0A7G2DWJ0 | 104-388 | None |
| B8BAS3 | 17-376 | None |
| A0A6A2XGK4 | 9-307 | None |
| A0A6P6GJJ5 | 276-620 | None |
| A0A1R3HPR1 | 685-1051 | None |
| A0A1J3G3M8 | 1-256 | None |
| A0A0E0QIZ5 | 534-934 | None |
| A0A834L885 | 488-790 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.